VIP
Price range: $46.96 through $61.60
Shipping
Tested
Checkout
Third-Party Lab Results
Transparency is our priority. Download the full HPLC and Mass Spectrometry reports for the current batch #88291. Tested on Oct 24, 2023.
DOWNLOAD FULL REPORT (PDF)VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.
VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.
- Peptide Name: Vasoactive Intestinal Peptide (VIP)
- Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
- Length: 28 amino acids
- Molecular Weight: ~3,327 Da
- Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
- Purity: ≥98% (HPLC verified)
- Format: Lyophilized powder, 10mg vial
Use: For laboratory research only, not for clinical or diagnostic use
All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.
- On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
- Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
- After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.
Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.
Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.
Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.
Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.
Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.
Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.
Researcher Reviews
Frequently Bought Together
5-amino-1mq 5MG
Original price was: $35.50.$28.40Current price is: $28.40.
ACE-031
Original price was: $134.00.$107.20Current price is: $107.20.
Reviews
There are no reviews yet.