PT-141 10mg Nasal Spray
PT-141 10mg Nasal Spray Original price was: $162.00.Current price is: $129.60.
Back to products
Thymosin Alpha-1
Thymosin Alpha-1 Original price was: $59.00.Current price is: $47.20.

VIP

★★★★★ 259 reviews

Original price was: $60.00.Current price is: $48.00.

In stock

✓ ...
✓ Free 2-day air shipping on orders $200+
Third-party tested — every batch
🎖 Verified veterans save 15% — for life. Learn More →
99%+ Purity Guaranteed
VETERAN MISSION
Same-Day
Shipping
Third-Party
Tested
Secure
Checkout
SCIENTIFIC SPECIFICATIONS
Molecular Formula
C147H238N44O42S
CAS
137525-51-0
Molar Mass
773.895 g/mol
Amino Acid Sequence
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn
Synonyms
VIP, Vasoactive Intestinal Polypeptide, PHM27
Solubility
Soluble in Water
Organoleptic Profile
White powder
Composition
Lyophilized powder – requires reconstitution
Research Use Only
Research Overview

vip Peptides Research Overview

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It binds to G protein–coupled receptors VPAC1 and VPAC2 to activate cAMP-dependent signaling pathways that mediate smooth muscle relaxation, vasodilation, immune modulation, and neuroendocrine communication.

VIP is widely used in research models to explore peptide-regulated vascular tone, neuroimmune interactions, epithelial homeostasis, and anti-inflammatory signaling. Its distribution across central and peripheral tissues makes it a versatile tool in both neuroscience and immunophysiology studies.

  • Peptide Name: Vasoactive Intestinal Peptide (VIP)
  • Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂
  • Length: 28 amino acids
  • Molecular Weight: ~3,327 Da
  • Receptor Targets: VPAC1, VPAC2 (Class B GPCRs)
  • Purity: ≥98% (HPLC verified)
  • Format: Lyophilized powder, 10mg vial

Use: For laboratory research only, not for clinical or diagnostic use

Storage & Handling

vip Peptides Storage & Handling

All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.

  • On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
  • Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
  • After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.

Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.

FAQ 

vip Peptides FAQ

Q: What receptors does VIP target?
A: VIP primarily binds to VPAC1 and VPAC2 receptors, activating cAMP-mediated intracellular signaling cascades.

Q: Is VIP used in cardiovascular research?
A: Yes, due to its potent vasodilatory effects, VIP is often studied for its impact on vascular tone and smooth muscle relaxation.

Q: Does VIP play a role in immune modulation?
A: Yes, VIP has been shown to regulate immune responses by modulating cytokine production and inflammatory signaling.

Q: Can VIP be used in brain research?
A: Absolutely. VIP is involved in neurotrophic signaling, synaptic maintenance, and neuron-glia interactions, making it valuable in CNS-focused research.

Q: Is this peptide intended for clinical use?
A: No. VIP 10mg is strictly for laboratory research and preclinical use. It is not approved for human consumption or therapeutic applications.

i
Research Use Only: This product is intended for laboratory research use only and is not for human consumption, diagnostic, or therapeutic use.