GLOW Blend 10 vial kit
Glow Blend 70mg (GHK-Cu 50mg, BPC-157 10mg, TB-500 10mg) 10 vial kit Original price was: $1,190.00.Current price is: $761.60.
Back to products
IGF-1 LR3 10 vial kit
IGF-1 LR3 10 vial kit Original price was: $670.00.Current price is: $428.80.

HGH 191AA 10 vial kit

★★★★★ 259 reviews
Purity 99.9%

Price range: $332.80 through $776.00

✓ ...
✓ Free 2-day air shipping on orders $200+
Third-party tested — every batch
🎖 Verified veterans save 15% — for life. Learn More →
99%+ Purity Guaranteed
VETERAN MISSION
Same-Day
Shipping
Third-Party
Tested
Secure
Checkout
SCIENTIFIC SPECIFICATIONS
Molecular Formula
C257H383N65O77S6
CAS
12629-01-5
Molar Mass
5807.57 g/mol
Amino Acid Sequence
A chain: GIVEQCCTSICSLYQLENYCN; B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Synonyms
Human insulin; Recombinant human insulin; Insulin
Solubility
Soluble in acidic aqueous solutions (pH < 3)
Form
Lyophilized powder
Research Use Only
Current batch Passed
Purity 99.9%

99.9% — exceeds our published 99% minimum

Batch
HGH-202604-001
Test date
April 30, 2026
Method
RP-HPLC (214 nm)
Lab
Bioviridian
College Station, TX
Certificate of Analysis as issued by the laboratory. Unedited.
Research Overview

HGH 191AA (Human Growth Hormone, somatropin) 10 vial kit

HGH 191aa – 15IU (Lyophilized Peptide) 10 vial kit – For Research Use Only

HGH 191AA 10 vial kit(191 amino acid sequence) is a synthetic form of human growth hormone identical to naturally occurring GH produced in the pituitary gland. It is widely researched for its potential roles in cell regeneration, muscle growth, fat metabolism, and anti-aging studies.

The 191aa sequence is considered the gold standard for HGH research due to its full biological activity and low risk of immunogenic response compared to 192aa analogs.

Product Details:

  • Peptide: HGH 191aa (Somatropin)

  • Quantity: 15IU per vial

  • Purity: >98%

  • Form: Lyophilized powder

  • Storage: Store at -4°F (-20°C). After reconstitution, refrigerate at 36–46°F (2–8°C) and use within 30 days.

  • Grade: For research purposes only. Not for human use, medical, or diagnostic applications.

Potential Research Applications:

  • Muscle growth and recovery studies

  • Fat loss and metabolic rate modeling

  • Anti-aging and cellular regeneration research

  • GH receptor signaling exploration


This product is intended for laboratory research use only. Not for human consumption or therapeutic use.

Storage & Handling

All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly.

  • On arrival: Store vials in a cool, dry place away from heat and direct sunlight.
  • Long-term (powder): For optimal longevity, keep lyophilized peptides refrigerated to help maintain integrity.
  • After reconstitution: Use an appropriate research diluent (for example, BAC water). Store the reconstituted solution in the refrigerator and use within 20–30 days for best stability.

Note: Minimize exposure to moisture and repeated freeze–thaw cycles. Follow your institution's safety procedures when handling research materials.

FAQ 

Q1: What is HGH 191AA 10 vial kit (Somatropin) in a research context?
A1: HGH 191AA 10 vial kit (Somatropin) is a recombinant, 191–amino acid human growth hormone identical to endogenous pituitary GH, used in laboratory models to study GH receptor signaling, IGF-1 regulation, and related endocrine pathways.

Q2: How is Somatropin different from other growth hormone–related peptides?
A2:
Somatropin replicates the full 191–amino acid sequence of natural human GH, whereas many GH secretagogues or analogues act indirectly by stimulating GH release or modifying specific domains of the hormone or receptor.

Q3: What types of experiments typically use HGH 191AA 10 vial kit?
A3: It is commonly used in receptor-binding studies, GH–IGF-1 axis investigations, metabolic and tissue-growth models, and as a standard in bioassays and immunoassays that quantify growth hormone activity.

Q4: Is HGH 191AA 10 vial kit (Somatropin) intended for performance enhancement or therapeutic use?
A4: No. Research-grade Somatropin is intended solely for scientific investigation by qualified professionals. It is not approved or marketed for performance enhancement, bodybuilding, or any therapeutic use in humans or animals.

Q5: Who should handleHGH 191AA 10 vial kit in the lab?
A5:
Only trained personnel working in appropriately equipped laboratories and following institutional and regulatory safety guidelines should handle HGH 191AA 10 vial kit.

i
Research Use Only: This product is intended for laboratory research use only and is not for human consumption, diagnostic, or therapeutic use.